GenomeNet

>mcx:BN42_41075 ligB; Putative ATP-dependent DNA ligase LigB (polydeoxyribonucleotide synthase [ATP]) (polynucleotide ligase [ATP]) (Sealase) (DNA repair protein) (DNA joinase) (EC:6.5.1.1); K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MLLHDVAITSMDVAATSSRLTKVARIAALLHHAAPDTQLITIIVSWLSGELPQRHIGVGW
AALRSLPPPAPQPALTVTGVDATLAKIGTLSGKGSQAQRAALVAELFSAATEAEQTFLLR
LLGGELRQGAKGGIMADAVAQAAGLPAATVQRAAMLGGNLAAAAAAGLSGAALHTFTLRV
GRPIGPMLAQTATSVHDALERHGGTTIFEAKLDGARVQIHRANDQVRIYTRSLDDVTARL
PEVVEATLALPVRDLVADGEAIALCPDNRPQRFQVTASRFGRSVDVAGALSAQMAEPLSV
FFFDILHRDGTDLLDAPTTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEG
VMAKAPTAPYLAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRRGKLSNIHLGARDPATGG
FVMVGKTFKGMTDAMLDWQTTRFHELAVGPTDGYVVQLRPEQVVEVALDGVQRSSRYPGG
LTLRFARVVRYRADKDPAEADTIDAVRALY

BLAST