GenomeNet

>mdo:100012303 K06744 programmed cell death protein 1 | (RefSeq) PDCD1; programmed cell death 1 (A)
MGGAASAGPPGSGGLGREAVRVWRRVCVRARSPTSLLPPEAPAHSGPWKGNRKERGATAC
GSPVLSLRLWVPRPLRWRACLEVRLLLSRGGLPRPPAWPGSRPPSSLHSLEYVGFSLSFS
RPRGEMLRSAASGGRAGAEGEGAGALPGLPSGSNGARFLSMTCQHPGGGPHCSQGRGRGG
RRPRPGASELLPFRGLRRPPDQVLAMRPSWGAGAAFCFVLLSWASGPSPVKMEYNLGFWP
PQLSKAEGENATFVCNVSRELMTSILNWYKEKNGSQPEKLAAYPKDKPSSPLQDRYHIAK
RNGQTYEMTIVGLQLNDSGRYFCGIINFQMPPVKESGWSELNVTERLMDSTTPTPFTTPE
ALEKFPRIIVVVSIIVGAVLVLLLLCWVLFIVESRGRGGAGNSESDKDSLKVERCAASGS
ASAVVYGQLDFQRPEAPPAGGAECCEQTEYAIIVFPPDKPGGSPHRK

BLAST