GenomeNet

>mdo:100017071 K00933 creatine kinase [EC:2.7.3.2] | (RefSeq) CKB; creatine kinase B (A)
MPFSNSHNMLKSRYTAEEEYPDLCSHNNHMAKVLTPELYEKLRDKVTPSGFTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYDVFKELFDPIIEDRHGGYKPSDEHKTDLNADNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLSVEALASLEGDLNGKYYALKNMT
EQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDGRGIWHNDNKTFLVWINEEDHLRVISM
QKGGNMKDVFTRFCTGLTQIETLFKTKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
HLGKHEKFGEVLKKLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLL
IEMEKRLEQGQSIDDLMPAQK

BLAST