GenomeNet

>mdo:100017071 creatine kinase B-type-like; K00933 creatine kinase [EC:2.7.3.2] (A)
MPFSNSHNMLKSRYTAEEEYPDLCSHNNHMAKVLTPELYEKLRDKVTPSGFTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYDVFKELFDPIIEDRHGGYKPSDEHKTDLNADNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLSVEALASLEGDLNGKYYALKNMT
EQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDGRGIWHNDNKTFLVWINEEDHLRVISM
QKGGNMKDVFTRFCTGLTQIETLFKTKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
HLGKHEKFGEVLKKLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLL
IEMEKRLEQGQSIDDLMPAQK

BLAST