GenomeNet

>mdo:100018749 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) TK2; thymidine kinase 2, mitochondrial (A)
MVPVRAWLRRLLLKTPGPGAGIRPRGPGATPAPGLGRLRPLAQLVRYQHLCPPELTTASG
PEGRLQPALPSGWPMDKHEKNEKDKKLVICIEGNIASGKTTCLDYFSKTADIEVLTEPVS
KWRNVRGHNPLGLMYQDASKWGLTFQTYVQLTMLDQHTKPRISPVRMMERSIHSAKYIFV
ENLFKSGKMPEVDYVVLSEWFDWIVKNIDVSVDLIVYLQTSPAACYERLKLRCREEEKII
PLEYLEAIHQLYEEWLIKQTLFRVPSPVLVVEADQDMQTMLEFYEQNRDQILTGGELKHH
L

BLAST