GenomeNet

>mdo:100022449 SETMAR; SET domain and mariner transposase fusion gene; K11433 histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43] (A)
MSEEQPQASSGALRDVGRGLENLPISLWPEGEEPVFQYTPEPVMGPGAETDPTQITFPGC
ACLTASCLPAACSCLLRGENYDHSCLRDIESEVEFARPMFECNVMCQCSEQCENRVXQRG
LQFSLQVFKTDKKGWGLRTLDLIPKGRFVCEYAGEILGTLEARRRIQQQTKHDSNYIIAV
REHICNGQIIETFVDPTHVGNVGRFLNHSCEPNLLMVPVRIDSMVPRLALFAAKDILPNE
ELSYDYSGRFHNLTKKNGNQEMSDKHKIGKPCHCGTKSCAAFLPYDSSLYSPLENPTTH

BLAST