GenomeNet

>mdo:100022914 K11424 histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43] | (RefSeq) NSD2, WHSC1; nuclear receptor binding SET domain protein 2 (A)
MNFSIRRNSPSLTQKIVSQLKMKQVPEILGNTNGKTQNCEVNRECSVFLSKAQISTTLPE
GVMQKFNGHEALPFIPAEKLKDLTSRVFNGESGAQDAKLRFESQEIKGIGTPPHTTPIKN
GSPEIKLKITKTYMNGKPLFESSICGDNGPDVSQSEENEQKLENKSRRNRKRSIKYDSLL
EQGLVEAALVSKASSPSEKKILAKRESYPNINKEKDHLLKYNVGDLVWSKVSGYPWWPCM
VSADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVSFEGEEQFEKLCQESAK
QAPTKAEKIKLLKPISGKLRTQWEMGIIQAKEAVSMTVEERKAKFTFVYVRDRLHLNPQV
AKEAGIAVDPLEEIEESSDMSEETAQNLKHKELGVPIKRRRRSKLLSCTDNLESDSGPKN
ITPQRAAEQADSKRGLGSPVGRKKAAASTPRSRKGDSGSQFLVFCQKHRDEVVAEHPDAS
SEEIEELLESQWNMLNEKQKARYNTKFAIVTSPKSEEDSGSSLKNIGDTKRKVFQDSPKR
RSRSRSNLHGKKRNNTKRTQHPTEDFEVQEPPRKRLRMDKQNNRKRETSNDKATKTNSSK
VTETSSSLKNQSATKNLSDACKPLKKRNRASATESSTLAFSKSSSPSTSLTENEISDGQG
DEPSESPYESADETQTEISISSKKSERGTTAKKEYVCQLCEKSGNLLLCEGPCYGAFHLS
CLGLSRRPEGKFICSECTSGIHSCFVCKEKKTEVKRCVVSQCGKFYHEACVKKYHLTVFE
SRGFRCPLHSCVSCHVTNPSNPRSSKGKMMRCVRCPVAYHGGDGCLAAGCSVIASNNIVC
TNHFTARKGKSHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWYCNDCR
AGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQ
ARVFPYMEGDRGSRYQGIKGIGKVFKNALHEAEARFREIKLQREARETQENERKPPPYKH
IKVNKPCGKVQIYTADVSEIPKCNCKPTDENPCGFDSECLNRMLMYECHPQVCPAGEQCQ
NQCFTKRQYPETKIIKTDGKGWGLVAKRDIKKGEFVNEYVGELIDEEECMARIKYAHEND
ITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGT
ELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKNSAALSSEEKGKKTKKKTRRRRTKGE
GKKESEDDCFRCGDGGQLVLCDRKCCTKAYHLSCLDLVKRPFGKWECPWHHCDVCGKPSV
SFCHFCPNSFCKEHQDGTVFSTTQDGRLCCSEHDFGVESIRNPKTEKPFPEPTKLKPKRK
KRRCWRRKTECK

BLAST