GenomeNet

>mdo:100027436 SETD7; SET domain containing (lysine methyltransferase) 7; K11431 histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43] (A)
MDSDDEMVEEAVEGHLDDDGLPHGLCTVTYSSTDRFEGHFVHGEKNGRGKFFFFDGSTLE
GLYVDDALQGQGVYTYEDGGVLKGTYADGELNGPAQEYDSDGRLIFKGQYKDNIRHGICW
IYYPDGGTLVGEVNEEGEMTGDKIAYVYPDGRTTIYGKFIDGELIEGKLATMSVEEGKPY
FELIPGSSLYHFDKSTPSCISTNPLLPDPYESERVYVADSHIPSAGEGLFSKVAVGPNTV
ISFYNGIRITHQEVDDRDWDLNGNTLSLDDETVIDVPEPYNHTSKYCASLGHKANHSFTP
NCIYDVFAHPRFGPIKCIRTKQAVERDEELTVAYGYDHNPPGKSMPEAPEWYRMELKVFQ
AAQEK

BLAST