GenomeNet

>mdo:100618514 SETD1B; SET domain containing 1B; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
FAKLNDNIRENFLTDMCKKYGEVEEVEILYNPKNKKHLGIAKVVFATVKGAREAVQHLHN
TSVMGNIIHVELDTKGETRMRFYELLVNGLYTPQTLPVGIELETSPTVNKTLQLTDALKR
LKDGSVASASSSASVTPNSSTPFSHDTAYSSSRLDTPNSYGQCTPLTPRLGTPFSQDSSY
SSRQPTPSYHFSQDSGYKARRHETKFTDAYNRRHEHHYVHNSLGAFRSSEHTFGTTATSS
SGGGGGGGGSSSYKPHVQPEAPQYSHTPPSAPLGHTSSNYKSAFSPYQAPALFAPHPEEP
ATMPAFAQGGRDSGEYRRAQPPVEPPAVVAPPAKERPETPPVPPPPPPPELNSSLEPSGG
PNFGWSPERCNSPRTPTLESSPSSSEKPHDSLDSRIEMLLKEQRTKLPFLREHDSDTELR
MEGSPISSSSSQLSPLPTFGPNSQPSFRGQTPSSRPSSTGLEDISPTPLPDSDDEDLGLG
LGPRPPPEPGPPDPAGLLGHGAETTKEMAGERTPTSEKMDEGQQSSGEDMEISDDELPSA
PITSADCPKPIVVNSSVTTPAVLATSIPLPPPGFPPPLPPPPPPPPQPGFPMPPPLPPPP
PPPPATHPKRKCWWQWAGMHMSFQMQTQMLSRMMQGQGVCQYPRFMGSGMQFVKLCPPYR
XPFSMGGAVGRGQQWPPLPKFDPSVPPPGYMPKKEDPHKATVDGVLLVIVKELKAIMKRD
LNRKMVEVVAFRAFDEWWDKKERMAKASLTPVKSGEHKDEERPKPKDRLTSCLLENWSKG
EGLGYEGMALSIGLRGAIRLPSFKVKRKEPPDPASTGDQKRLRPSTSVDEEDEESERDRD
MSDIPSDLSKKDPDGVSIRRRPARPLELDSEGEEEDDKEESSSSSSSSSSSSSSSSSSLS
SSSSSSSEKEEDEEDRLAKTSSDKEEEEEDVDEEEEEDEEDDEEDEEETAEVEMSEKEGL
NSDEEDVRSMASSKVEPASSEESEDSSDYESTSESEEEEEEEEEEEEEEEEEATAAAEAE
SEEVMEEALLGKAKTCQEPKLMEAGTIVKEEEEEMITILELTPVMDEPGSTGLRAEETVG
SGDAPEQPGLKQVDMMLEELPTPGPPEPQRHLTPSPVDASGEETELESSEVLKEMSFLSR
PPSPPGLPPEATPQQGSFLREVEVEGRPHTIGPKVVLPLEPESLRLQPLFPARPSQPLPL
LEEPLPEELPPRTPGRDPLAKSQSTETVPATPGSETPLTASSLALSSPQVPSSPFSYPSQ
SPGLSGGGIPRTPGRDFSFTPTFPEPMGPLPLSVCSLPPGKKLPGDDRPGPGAPTSSSPL
ESGFPLPVSLPVPLSVPVPLPVPLTLPPGPLLPRSPTLLPLPLTLPLALPLAPSLPTPCP
SPIKRKPGRPKRSPPAVLTLDVPPGRLATLPPEAAGHKLLLLAGQPPATAAFHGAPDPRV
VTLDFRNDGGLPPPPPPPPPPPPPPDEATKLPFKELENQWLEEPPPPSLGLEEEVDSGNG
GGFSKPKLPWRRPPKKRHEDMVVPPLPPPSPDFSAFGVVLCRILVSGLDLSPPTSFSTPK
KKKREDGIREHVTGCARSEGYYKIDKKDKLKYLNNSRAFAEEPPADTQGMSIPAQPHAST
RAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADE
MVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPN
CYAKVITVESQKKIVIYSKQHISVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN

BLAST