GenomeNet

>mdo:751085 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) SDHA; succinate dehydrogenase complex flavoprotein subunit A (A)
MSGVSVAARLLVRRRLALTRSQWPIAFHSNTRSFHFTVSGEKRSSAKVSNSISTQYPVVD
HEFDALVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTEEGKIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCI
EDGSIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGP
EKDHVYLQLHHLPPEQLSTRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLTHVNGRDQVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALSIAETCKPGD
KVPQIKANAGEESVANLDKLRFASGDIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCQIL
SQLYNDLKNLKTFDRGMVWNTDLVETLELQNLMLCALQTIHGAEARKESRGAHAREDYKV
RIDEYDYSKPIEGQRKKPFEEHWRKHTLSYVDVKTGKVSLEYRPVIDKTLNEADCATVPP
AIRSY

BLAST