GenomeNet

>mem:Memar_2179 hypothetical protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MAGPDMLDEYHEKRDFSRTPEPPGEREVSSRPIFVIQKHAATTLHYDFRLEVDGVLKSWA
VPKGPSMSPKEKRLAVPTEDHPLEYADFEGVIPEGSYGAGTVLVWDRGTYQNLTGRKGER
IEVAEAVRRGHVSFLLDGEKIRGGYALTRFRTGKGEAWLLVKMDDAEADPGRNPVATEPR
SVVSGRTIEEIGAGRKE

BLAST