GenomeNet

>mem:Memar_2179 hypothetical protein (A)
MAGPDMLDEYHEKRDFSRTPEPPGEREVSSRPIFVIQKHAATTLHYDFRLEVDGVLKSWA
VPKGPSMSPKEKRLAVPTEDHPLEYADFEGVIPEGSYGAGTVLVWDRGTYQNLTGRKGER
IEVAEAVRRGHVSFLLDGEKIRGGYALTRFRTGKGEAWLLVKMDDAEADPGRNPVATEPR
SVVSGRTIEEIGAGRKE

BLAST