GenomeNet

>mem:Memar_2179 no KO assigned | (GenBank) conserved hypothetical protein (A)
MAGPDMLDEYHEKRDFSRTPEPPGEREVSSRPIFVIQKHAATTLHYDFRLEVDGVLKSWA
VPKGPSMSPKEKRLAVPTEDHPLEYADFEGVIPEGSYGAGTVLVWDRGTYQNLTGRKGER
IEVAEAVRRGHVSFLLDGEKIRGGYALTRFRTGKGEAWLLVKMDDAEADPGRNPVATEPR
SVVSGRTIEEIGAGRKE

BLAST