GenomeNet

>mep:MPQ_0638 glutathione s-transferase domain-containing protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MKLYYSLTSPYARKVRVVAAEKRIDIEMVQVVLSDPDCPVPDHNPLGKIPVLVLDDGESI
FDSRVIVEFLDHRTPVAHLIPQDHGQKIRVRRWEALADGVCDAAVAVIMEGRRAPEKQDA
AALEKQMGKVTRGLAAMNDELGAAKWCVNGNFSLADIALGCVLGYLDLRYSDLGWQDTYP
NLARHYAAMLQRPSFKDTMPPAQ

BLAST