GenomeNet

>mes:Meso_1150 ATP dependent DNA ligase; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MALTTYRRKRNFSATPEPPGEEKASPRGDSFVIQKHAARRLHYDLRLEMDGVLKSWAVTR
GPSLVPGEKRLAVHVEDHPLDYGDFEGTIPKGEYGGGTVIVWDRGSWSPIGDAKKGYAKG
HLEFELHGEKLTGRWHLVRMAKKPREKKENWLLIKGEDDAARSEADPDILEERPESVKTG
RVIEEVEGEAPGWSSKTGRIEQPAEAKPARKKRATKAGSEKSAGEKISVPKRAKKAGYPG
FIEPALATLRSTPPPGGRWLHEIKFDGYRLQAHIRDGKARLLTRSGLDWTEKFGDAIVTA
LGSLPVRQAIMDGELIVEGAGGASDFSALQAALSEGRVDRMALYLFDLLYLDGYDFRPVP
LAERKATLQKLLDGAPPVLRYSEHFEEDGELVFRHACRLSLEGIVSKAGDAAYRSGRGKD
WIKSKCSMRQEFVVAGYVPSTTSNRAIGSLVLGYYENERLIYAGRVGTGFSHALAQDLFK
RLDKMRIAKSPFAKKLTSEEARGAKFVRPELVAEVEFRTWTADNLIRHASFRGLREDKSA
TDVTRETNQSKPAERAAPAIRLTHPDRIYWKDAGVTKQGLSDYYAEVWPRMGPFIVNRPL
ALVRCPDGVEGQCFFQKHAWRGQSHEIMKAVDPEDDEPIIAIDGLPGLIGLVQGGTLEIH
PWGSQLEDLERPDLINMDLDPGPDVTWQDVIDAAREVRERLAQAGLESFVKTSGGKGLHV
VAPLKPRADWPEVKAFAKGIADAMASDTPERFVATVTKAKRKGKILVDYLRNGRGATAVA
PYSTRARAGAAVSMPLFWEELSPAITADYFTVANAPTRLAAIGKDPWEDFWRAAVPLGRK
ARRAA

BLAST