GenomeNet

>mes:Meso_1301 hypothetical protein (A)
MQREGRETIAGISLSHPDKVLFESQGLTKADIARHYLRVADRMLPAIRNRLVSLVRCPDG
PSQECFFQKHAGRGFPSAVKRREITEKDGDKAEYLYTNDLKGIVAGVQMNTLEFHIWGSR
IDAIEKPDRLVFDLDPDEGLGFADVKQACFDLRHRLEGLGLQTLPMVTGGKGIHVVAPLS
RRAEWPEVKAFARALAYRMGEEEPERFLAQASKEKRKGRIFIDWLRNERGATAIAPYSTR
ARQGAPIAMPVSWEELRGLDAANTFHVQDMEARMAAPDPWAEAAGWRQSITRKLLEKAGA
E

BLAST