GenomeNet

>mev:Metev_1330 glycoside hydrolase family protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MKSVCFCGEVHLPLNLKWYWPAYEYTKPSIDKYFDLPQVYSSFDKIGYDVIRTNEVIKES
IENGGKYSFNISGTFIDICKKWNFDVIKSFKELSNTEKVEFTSSSYYHSLSSLYNDSFEF
RDQIKKHRNEINNLFEQNPQTFIDSELILTTHTGSILQDQGFECIISEGSSNLLDGTDPV
YVYNNQLPILLRHINLSEDIETRFSDRSWTGYPLIPDKFASWINNMEGDVVVIYFNYDTL
ARHHENGSNIFQFLKELPESLKKYDIKMETPSEAVKKHQKVKLDNLNIESTARFGMDSLT
GNHMQNLYLCELMGINKDLQKIKESPDYNFLKQIYGYLQQSDIFLDMNYNNLPLAYERGV
NNFSIISDFRRAVIEEAGQIKKMEAGQ

BLAST