GenomeNet

>mez:Mtc_0300 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) hypothetical protein (A)
MKNDLAPAYTLSLVMLRKCVVIAMALLALAPALALPTTSQSPEIGVSQIPVDLPQEYMEG
GNAPGTASYYEARYRSAVVSNVLTFQKKMNSGRVAFGRQMDSQYFNTRYWEQAYVDGSQF
WKVKGGVSNTEALNDFISPTGGKYKLDCAAAINLILLKSKLDVVGEKSFNKHLPVLMIRG
WKTYTIKDGSFEEYQTLEVWSGDERTPGTPEGLKVGDYVYFKNHPMMEGTPEQGENAIYL
GRDRWGRPLFFGLNIGIRAGIMHQYGILTTERGTIDPEALKRMAES

BLAST