GenomeNet

>mez:Mtc_2068 DNA ligase D, 3'-phosphoesterase domain protein (EC:6.5.1.1) (A)
MPEHPIYVIQKHAASHLHYDFRLEVCGVLKSWAIPKGPSTDPRVKRLAMPTEDHPLEYAT
FEGVIPEGQYGAGTVMVWDIGTYRNLRGDEADMEQAYGEGRIEVWLEGRKLKGGYALIRA
GRMGDKRGWLLIKMRDEYANKPEDPAVTEPDSALTGRTLEEISGG

BLAST