GenomeNet

>mfo:Metfor_0961 DNA ligase D-like 3'-phosphoesterase domain-containing protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MTGGTTPRFVLHEHFARHHHFDFRLEHDGVLASWAVPKGLPEKAGERRLAIAVEDHPLDY
IGFEGTIPEGDYGAGEVKIADTGTYEPLEWGPGRIEVHLSGSRYTGKYVLIRFKKAGERE
WLVLRTKV

BLAST