GenomeNet

>mfo:Metfor_0961 no KO assigned | (GenBank) DNA ligase D-like 3'-phosphoesterase domain-containing protein (A)
MTGGTTPRFVLHEHFARHHHFDFRLEHDGVLASWAVPKGLPEKAGERRLAIAVEDHPLDY
IGFEGTIPEGDYGAGEVKIADTGTYEPLEWGPGRIEVHLSGSRYTGKYVLIRFKKAGERE
WLVLRTKV

BLAST