GenomeNet

>mfu:LILAB_16510 D-ala D-ala ligase domain-containing protein; K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MHIILLHNRDHDLLEDDPGREAREDVVRVVSSLADALNQGDTLAEPLAIEGDRLDFVDTL
RRRQPDLVVNLCESLAADSRGEMAVPCLLDALGLAYTGSSALSLGLALHKPKAKEVLTAR
GVSTPPFRVVERLEDALAVDLPWPLIVKPAREDASMGVTSESVVHERAALVRACDAVLRE
FHQPALVEQFIPGREIYVPLLGNQPRQALPLTEIVFGRTFEDRPNIVSYNAKWEAASAEY
RDTTSGLCRLDANLESRCVQVALEAFAALDCQDYGRVDLRVSPEGVPYVIDINPNCDLHP
SAGFAKAALAAGMDYPALASRLVEVALERAHGHPSHRRKGPGADRRADSKDRNLLAAGG

BLAST