GenomeNet

>mfu:LILAB_16510 K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) D-ala D-ala ligase domain-containing protein (A)
MHIILLHNRDHDLLEDDPGREAREDVVRVVSSLADALNQGDTLAEPLAIEGDRLDFVDTL
RRRQPDLVVNLCESLAADSRGEMAVPCLLDALGLAYTGSSALSLGLALHKPKAKEVLTAR
GVSTPPFRVVERLEDALAVDLPWPLIVKPAREDASMGVTSESVVHERAALVRACDAVLRE
FHQPALVEQFIPGREIYVPLLGNQPRQALPLTEIVFGRTFEDRPNIVSYNAKWEAASAEY
RDTTSGLCRLDANLESRCVQVALEAFAALDCQDYGRVDLRVSPEGVPYVIDINPNCDLHP
SAGFAKAALAAGMDYPALASRLVEVALERAHGHPSHRRKGPGADRRADSKDRNLLAAGG

BLAST