GenomeNet

>mgi:Mflv_1274 DNA primase, small subunit; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MPSPATELDVDGVKVRFTNPDKPYFPKLGKNGTKGKLLEYYLAVADPMVTLLRDRPVHLQ
RFPDGIDGEEIYQKRVPQKHPDYLETCTVTFPSGRTADALKITHPSAIAWAAQMGTVTLH
PWQVRCPDTEHPDELRIDLDPQPGTGFTEAADVAVGVLKPLLDELGLVGYPKTSGGRGVH
VFLRIKTDWDFIAVRRAGIALAREVERRAPDAVTTSWWKEERGKRLFIDYNQNARDRTFA
SPYSARKTPIATVSTPLTWEELRDAEPDDYTIQTVPDFIAGRPDPWAGIDDNAQSIDTLL
EMVHADEERGEGDLPYPPSYPKMPGEPPRVQPSKKVAAHWDEHGNRIAD

BLAST