GenomeNet

>mgi:Mflv_1274 no KO assigned | (GenBank) DNA primase, small subunit (A)
MPSPATELDVDGVKVRFTNPDKPYFPKLGKNGTKGKLLEYYLAVADPMVTLLRDRPVHLQ
RFPDGIDGEEIYQKRVPQKHPDYLETCTVTFPSGRTADALKITHPSAIAWAAQMGTVTLH
PWQVRCPDTEHPDELRIDLDPQPGTGFTEAADVAVGVLKPLLDELGLVGYPKTSGGRGVH
VFLRIKTDWDFIAVRRAGIALAREVERRAPDAVTTSWWKEERGKRLFIDYNQNARDRTFA
SPYSARKTPIATVSTPLTWEELRDAEPDDYTIQTVPDFIAGRPDPWAGIDDNAQSIDTLL
EMVHADEERGEGDLPYPPSYPKMPGEPPRVQPSKKVAAHWDEHGNRIAD

BLAST