GenomeNet

>mgl:MGL_0349 K01895 acetyl-CoA synthetase [EC:6.2.1.1] | (RefSeq) hypothetical protein (A)
MSENEFINIPSRVNGSDKTRPRAHIDETMYNQMHHRSIHENDQFWAEEANRMISWYVPFK
TVQYGDFGRGNIGWFLEGQLNASYNLVDRWAFERPDDIALIWEADEPGSHIYISFSELLD
RVCQVAGVLHSLGVRKGDIVIIYMPMIPEAVISMLACARIGAVHSVVFAGFSSDSLRDRV
QDSRTRVVMTSDEGRRGGRTIATKSIVDAALKECSSVEHVLVAKRTGAVDVPWVDGRDKW
LSELAAQQRTYFPPVSMNSEDPLFVLYTSGSTGKPKGIVHTTAGYLLGAGLSVKHVFDVH
PGDRFGCMADIGWITGHTYIVYGPLMNGTATLIFESTPMYPTPSRYWEVVDTHKLTQFYT
APTSIRMLRRMGPEHVQNYDLSTLRVLGTVGEPINPEAWHWYNEVVGRGHCAIVDTYWMT
EGGSHMITSLPGAIKSKPGAASKPFWGLKPVLLDSQTGQELQGVDTEGVLAMSRPWPSLA
RTILNDHSRFLDTYMRPYPGYFFTGDSAYRDKDGYIWIRGRVDDVINVSGHRLSTSEIES
ALAEHPGVAESAAVGAPDELTGQTIAVFVALKPDYVYDSLEDLTKELSIQVRRAIGPFAT
PKRILCVRDLPKTRSGKIVRRVLRKIVCNEADQLGDLSTLSDPSVLDHLLVRADIGATAP
CMTSRYCD

BLAST