GenomeNet

>mgl:MGL_0609 hypothetical protein; K11404 histone deacetylase 3 [EC:3.5.1.98] (A)
MKPARLALTNRLVHGYGLHKYMSVYSPRWASREELEMFHDSDYVDFLSTATPSTPLSSAF
TRFNFADDCPVFDGMYDFCRAYAGSSLAAARRLAAGATDIAINWTGGLHHAKKFEASGFC
YINDIVLAILELLRTFPRVLYIDIDIHHGDGVQEAFYTSNRVMTVSFHKYGNDFFPCTGD
ISETGVGLGKHFCLNVPLQDGIDDGAYVCLFKSVIEPCVYTFQPSAIVLQCGADSLGLDR
LGCFNLSIAAHGECVAFTKAFGLPMLVLGGGGYTIRNVARCWTYETSVLTGTQIPDDLPH
TPYDAFFAPTHRLHEPLIARVENQNTRTSLERTRIQVLEKLRYLHGAPSVQMNELPPDLA
GGWVDEPIKDYP

BLAST