GenomeNet

>mgp:100542100 angiotensin-converting enzyme-like; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MPAALGLLLPWLSLVGALQPGLEPPSXDPTEAGAVLFADAYNSTAEIVLFQSVSASWNYN
TNLTTANAALQVEASLEEQNFTELWGKKAKELYGNMWSNFSDPQLKSLLNSHSHPLPALM
PFPSPQYNTILSDMDKIYSTAKVCLDNGTCWDLEPDISDIMASSRSYRSSXLAWEGWHNA
AGNPLRAKYEEFVTLSNEAYQMDGFEDTGSYWRSWYDSTTFEDDLEHLYNQLEPLYLNLH
AFVRRKLYDRYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLMVPYPDKPNLDVTSTMVNQ
GWNATHMFRVSEEFFTSLGLLEMPPEFWDKSMLEKPADGREVVCHASAWDFYNRKDFRIK
QCTTVTMEQLFTVHHEMGHVQYYLQYKDQPVSFRGGANPGFHEAIGDVMSLSVSTPSHLQ
KIGLLSSAVEDEESNINYLLKMALEKIAFLPFGYLIDQWRWNVFNGRTPPSRYNYDWWYL
SHALGYICFPLSPVLTFTGFLGRYFVSFILQFQFHKALCQAANHTGPLHTCDIYMSKEAG
AKLREVLKAGSSKSWQEILFNLTGTDKMDMDAGALLEYFSPVTTWLQEQNNKTNEVLGWP
EFDWRPPVPEGYPEGIDKIVDEAQAKEFLSEYNSTAEVVWNAYTEASWDYNTNITDHNRE
VMLEKNLAMSKHTIEYGMRARQFDPSDFQDETVTRILNKLSVLERAALPEDELMEYNTLL
SEMETTYSVAKVCRENNTCHPLDPDLTDILATSRDYNELLFAWKGWRDASGAKIKDKYKR
YVELSNKAAVLNGYTDNGAYWRSLYETPTFEEDLERLYLQLQPLYLNLHAYVRRALYNKY
GAEHISLRGPIPAHLLGNMWAQSWSNIFDLVMPFPDATKVDATPAMKQQGWTPKMMFEES
DRFFTSLGLIPMPQEFWDKSMIEKPADGREVVCHASAWDFYNRKDFRIKQCTVVNMDDLI
TVHHEMGHVQYFLQYMDQPISFRDGANPGFHEAIGDVMALSVSTPKHLHSINLLDQVTEN
EESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNQQWWNLRLKYQGLCSPV
PRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHEALCKAAGHTGPLHTCDIYQSKEAG
KLLGDAMKLGFSKPWPEAMQLITGQPNMSAEALMSYFEPLMTWLVKENTKNGEVLGWPDY
SWTPYAATELHAATDTTDFLGMSVGTKQATAGAWVLLALALVFLIVSIFLGVKLFSSRRK
AFKSSSEMELK

BLAST