GenomeNet

>mgp:100542248 K05620 transglutaminase 3 [EC:2.3.2.13] | (RefSeq) protein-glutamine gamma-glutamyltransferase E-like (A)
MGQALTQPSTDWHVKENGRDHHTSKFSTKELIVRRGQAFVITFNGTEQPEQTLTFIAETG
PKPSKQAKTQATFGISSTASKEGWSAVLQSTSSHSVSISISSPANAVIGRYKLSVQSTST
GSSSPVVLGTFVLLFNPWSSGDDVFMPNKAECEEYVLEEFGIIFAGNSNHINSFGWNFGQ
FQADILNICLSMLDRSLNYRKDPATDVSHRYDPKYLGRVLSAMVNANDDQGVVLGNWSGN
YDGGKSPSSWTGSGEILQNWKKSGFKPVRYGQCWVFAAVLTTVLRCLGIPTRTITNFSSA
HDADGNLRVDEFYDASGNHLNEGADSVWNFHVWNESWFSRKDLGPSYSGWQILDATPQEE
SGGIYQCGPASRNAIKEGDVDLDYDCPFVFAEVNADCMYWNYDPATRKKTLLFNKSTVIG
QLISTKAVGRNDRIDVTSDYKYEEGSKKERDIFKKARKKLGLEDKFDPTAPTPKEIEQKP
DISGKFKMAGPLEVGKDLNLILVLTNLQSEVKSVQVNMTAWSTLYTRRPVREIWKDSLSV
SLSPEEEKQFPIKISYAEYQQQLTTDNAIEVTALCHVEGGIQVLVQRHIALDNPAIDIQV
LGEAKVNKEVEVEVVFTNPIDTEVKDCVLQVEGSDLLRGILMIDVPPLKGKEISSTKFKL
TPFETGSKHLLVNFSCDKFADIKAFKTVKVID

BLAST