GenomeNet

>mgp:100542248 protein-glutamine gamma-glutamyltransferase E-like; K05620 transglutaminase 3 [EC:2.3.2.13] (A)
MGTWARSLLCFTARELRRNLEWLQRNAQLWDTDTWNGTAQAMPGEARRGQASIRIAQCTA
KRWRKMLRKIAAVQEQDPDRRLPFPSHRAYLKGRQHKPAEPTARSSPKCPAGQPRPLAAE
LDAQRCTPTSSACPKCSTVGEANFLKTAPALHMRTSSKVLAAAVCWMKCGTAGASLFTHI
WGSGARVSALLFMRGSVSTSPLPQQAAALSPLLYTAPIVPRFFQQVAAALTLTQPSTDWH
VKENGRDHHTSKFSTKELIVRRGQAFVITFNGTEQPEQTXXQRPKPSKQAKTQATFGISS
TASKEGWSAVLQSTSSHSVSISISSPANAVIGRYKLSVQSTSTGSSSPVVLGTFVLLFNP
WSSGDDVFMPNKAECEEYVLEEFGIIFAGNSNHINSFGWNFGQFQADILNICLSMLDRSL
NYRKDPATDVSHRYDPKYLGRVLSAMVNANDDQGVVLGNWSGNYDGGKSPSSWTGSGEIL
QNWKKSGFKPVRYGQCWVFAAVLTTVLRCLGIPTRTITNFSSAHDADGNLRVDEFYDASG
NHLNEGADSVWNFHVWNESWFSRKDLGPSYSGWQILDATPQEESGGIYQCGPASRNAIKE
GDVDLDYDCPFVFAEVNADCMYWNYDPATRKKTLLFNKSTVIGQLISTKAVGRNDRIDVT
SDYKYEEGSKKERDIFKKARKKLGLEDKFDPTAPTPKEIEQKPDISGKFKMAGPLEVGKD
LNLILVLTNLQSEVKSVQVNMTAWSTLYTRRPVREIWKDSLSVSLSPEEEKQFPIKISYA
EYQQQLTTDNAIEVTALCHVEGGIQVLVQRHIALDNPAIDIQVLGEAKVNKEVEVEVVFT
NPIDTEVKDCVLQVEGSDLLRGILMIDVPPLKGKEISSTKFKLTPFETGSKHLLVNFSCD
KFADIKAFKTVKVID

BLAST