GenomeNet

>mgp:100542556 K05624 transglutaminase 6 [EC:2.3.2.13] | (RefSeq) protein-glutamine gamma-glutamyltransferase 6-like (A)
MYKFKGMFSMNLLYVFLAQKITNIDWHSKLNKAAHHTSDYNSMQVILRRGQAFTITLNFQ
TTVQPEDNFTFIASTGNFLVALTSHRGCSSFKTLLPHSFLANEIIVDSGFSPTPITQNCC
LLFPLAGLSPAESQQTKAIFHLSEDAASGWSATQEHCEPGRMSLIIVSPANAIIGRYKLK
LQIASGNKTSSALLGQFVLLFNPWCPNDDVYMANENERQEYVLNDSGIIFQGKEKYIQQE
AWNYGQFEEDILDISLSILDRSLNHRQDPSTDVSNRNDPIYVCRVISAMVNSNDEKGVVE
GKWSGNYRSGTNPLHWSGSVTILRKWYRGRYKPVRYGQCWVFAGVMCTVLRSLGIPTRVI
TNFNSAHDSNINLSIDKYIDVSGNTLNLTEDSVWNFHVWNESWFTRRDLGSFYDGWQVLD
ATPQEKSKGIYRCGPASTRAIKEGDVNLDYDSSFVFAAVNADCVTWIQHSNKRKERIYSN
TRKIGKFISTKAVGTNTRVDITDNYKYPEGSSKERQVYKKALKLLAVRNTGKRKKVTKPT
RRFPVARRQNMRATTRKPTVSGKLKLDASTVIGQDILLTLALQNLTAEFKTMKVKLKASA
VLYTRKPKAEILQWSRTVQLGSEEVKEISFKITYSQYKNALLDDRKILVTAVCEDRQGAS
LLLEKDIVLQDPLLTIEVLGPTVVHKATNVLVTFTNPLSEVVTDCVLRAEGSGLLKEQLN
INVARMAPMETSTAEFEIIPYKSGIRQLQVDLACIRFSNIKGFVMLDVAPAQ

BLAST