GenomeNet

>mgp:100546340 succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MKITQSNSLFFIVRSGSFLLVLVCVELVMIKEWPAACQTFARNFHFTVDGKRSASAKVSD
SISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINA
ALGNMEDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIY
QRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENG
ECRGVIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQD
LEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTI
EIREGRGCGPEKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYN
MGGIPTNYKGQVITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACAL
TIAETCKPGEPVPSIKPNAGEESVANLDKLRFADGTIRTSEVRLNMQKIRSKLRKLLCRT
PSTVFQILLGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKLRIDEFD
YSKPLQGQQKRPFEEHWRKHTLSYVDVKSGKVTLKYRPVIDRTLNEEDCSTVPPAIRSY

BLAST