GenomeNet

>mhi:Mhar_0357 hypothetical protein; K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] (A)
MNLGAVAERLGISAERMEKILGRIVRPSDWPPPRLLRFDKAVAGIEAGTVVFDEDEIVFG
YPKIRRAMMLDPALRRHFSSGVLVEEKMNGHNVRVARVGESTVALTRGGFICPYSTEVAR
EQIPPEIFRDHPDLVLSGEMVGPKNPYVPKEVYPAEAMDFYLFDTSRKGRRDLEGPLRTH
ALAEEYGIRAVRLFGEFGLQQAAAEIREIVRDLGARGREGVIVKDPENLARPIKYTSSES
NCRDLEYAFRYYNDYGQDFFFSRVVREGFQAAEWAEGEAEFLERCLRLGRSMLTPMRETV
EAKMVGEPIVQEVEILVRDLQTARDFEEHFRRMGVRAIFDPPRNSRGGHLVKIKRLVLST
NDKTESIVEGQLW

BLAST