GenomeNet

>mht:D648_12800 Thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAKLYFYYSSMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRFGVGKVNSRIGISQEAN
LFTADTNLFAEIKALHSNKALHCILIDEAQFLTKTQVYQLSDVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADELEELKTICDCGKKAHFVVRLNEKGEAIKDGEQIQIGGNDRYLS
VCRYHYKQKLGKL

BLAST