GenomeNet

>mhz:Metho_2160 ATP-grasp enzyme, D-alanine-D-alanine ligase; K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MNINTLVDPQKKCAPKPKSLGPVSSLEEHVNPDWWKKIFNSLYLKTDADVVGDSEITREE
IDMFLSVLNLAQESKILDLCCGQGRHSMEVSRRGFKNVEGLDRSHYLIQKAKSVAKREGL
NVRFREGDARKTPYSTDNFDAVFLLGNSFGYFETSEEDLRVLNEVKRVLKPWGKVLLDVT
DGSYLKSNYQPRSWEWIDKHNFVCRERSLSLDDQKLISREVIVNDEQGVIADQFYAERLY
TQESLQELLKKAGFSDVEVVNSIGSNSKRNQDLGMMEKRIIITANLRKEWTEPKKKVHAI
QKDVVVVFGDPSKRDSLKPCGVFDDDDLYTIDQLKGALKERGEYSFKFLDNHDTLIQDLQ
RLKGKVDFIFNLCDEGYSNDPLKELHVPALLEILGIPYTGSGPQCLAFCYDKALVRGIAK
DLGVPVSEGIVIKAEDVLFEVPMQFPVIVKPNFGDSSFGLNQHSVCHNRDEVVRAIYDIR
EGLGYDKPILVEEFLTGKDLSIGIIGNPPENYTVLPIIEEDYSELPSELPRMCGYEAKWI
PDSPYWKIHSIAAEIPKDVEEFILECSLKMITRLECRDYTRLDWRMDAAGNPKLLEVNPN
PGWCWDGHLAKMAALAGISYPEMIASILKSTDERITGAEPVKSSGPVPEFKFELC

BLAST