GenomeNet

>mia:OCU_03270 hypothetical protein (A)
MAAAEEVDVDGVAVRLTNPDKVYFPKLGSRGTKRHLVEYYRAVAGGPMLDTLRDRPSHLQ
RFPDGIDGEEIYQKRIPQHHPDYLETCQVTFPSGRTADALKVTHPAAIVWAAQMGTITLH
PWQVRCPDTDHPDELRIDLDPQPGVAFEQARTVAVDVLRPLLDELGLVGYPKTSGGRGIH
VFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTAWWKEERGERIFVDFNQNARDRTMA
SAYSVRRTPIATVSMPLTWDELAGAEPDDYTMATVPELVARREDPWAAMDDVAQSIASLL
EMAEADEERGLGDMPYPPNNPKMPGEPKRVQPSRDTDRRNGKK

BLAST