GenomeNet

>mia:OCU_29800 no KO assigned | (GenBank) DNA polymerase LigD ligase subunit (EC:6.5.1.1) (A)
MTDFASLPGAVREALYDEPVPDWRSPTLATLTDDRFSDPHWIFERKFDGMRCLAFRDGDR
VRLLSRNRQPLNGTYPELVDALAAQPVTRFVVDGEVVAFDGRRTSFARLQGRLGLTDPDV
ARASPVRVFYYVFDLLHLDGMSTVEVPLLWRKRLLRKAIDFADPLRCAPHRVGDGIAAYR
RACERGDEGVIAKRADSTYQGGRSKNWLKFKCVRDQEFVVGGYTSPKGSRVELGALMLGY
YEGGDLVYAGKVGTGFDDATLRRLHARLSPITRDTPPFARGLVREAGANWVSPEMVVQIG
FSEWTRDGKLRHPRYLGMRTDKEPGEVVRETH

BLAST