GenomeNet

>mia:OCU_29800 DNA polymerase LigD ligase subunit (EC:6.5.1.1); K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MTDFASLPGAVREALYDEPVPDWRSPTLATLTDDRFSDPHWIFERKFDGMRCLAFRDGDR
VRLLSRNRQPLNGTYPELVDALAAQPVTRFVVDGEVVAFDGRRTSFARLQGRLGLTDPDV
ARASPVRVFYYVFDLLHLDGMSTVEVPLLWRKRLLRKAIDFADPLRCAPHRVGDGIAAYR
RACERGDEGVIAKRADSTYQGGRSKNWLKFKCVRDQEFVVGGYTSPKGSRVELGALMLGY
YEGGDLVYAGKVGTGFDDATLRRLHARLSPITRDTPPFARGLVREAGANWVSPEMVVQIG
FSEWTRDGKLRHPRYLGMRTDKEPGEVVRETH

BLAST