GenomeNet

>mia:OCU_37080 glycoside hydrolase family protein; K16150 glycogen(starch) synthase [EC:2.4.1.11] (A)
MKILMVSWEYPPVVVGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDPRSHPSSDQISEG
VRVIAAAQDPHEFTFGTDMMAWTLAMGHSMVRAGLSLKKPGSSHAWRPDVVHAHDWLVAH
PAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSGSMAD
EITELFGPGLAEITVICNGIETARWPFAARRPRTGPAELLYLGRLEYEKGVHDVIAALPR
VRRTHPGTTLTIAGEGTQQGWLIEQARKHRVFKAIRFVGHLEHAELLAVLHRADAAVLPS
HYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGRTGVSCPPRDVTRLAAAIRTVLDDPR
AAQQRARAARERLTSDFDWHTVADKTAQVYLSAKRGERQPQARLPIVEHALPDR

BLAST