GenomeNet

>mia:OCU_37080 K16150 glycogen synthase [EC:2.4.1.11] | (GenBank) glycosyl transferase, group 1 family protein (A)
MKILMVSWEYPPVVVGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDPRSHPSSDQISEG
VRVIAAAQDPHEFTFGTDMMAWTLAMGHSMVRAGLSLKKPGSSHAWRPDVVHAHDWLVAH
PAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSGSMAD
EITELFGPGLAEITVICNGIETARWPFAARRPRTGPAELLYLGRLEYEKGVHDVIAALPR
VRRTHPGTTLTIAGEGTQQGWLIEQARKHRVFKAIRFVGHLEHAELLAVLHRADAAVLPS
HYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGRTGVSCPPRDVTRLAAAIRTVLDDPR
AAQQRARAARERLTSDFDWHTVADKTAQVYLSAKRGERQPQARLPIVEHALPDR

BLAST