GenomeNet

>mic:Mic7113_3623 heme peroxidase family protein (A)
MARDTSRDGLSNKALVYALSNFKPLWNLVQSYEPLKRKINKFFLNSIIYKIPTRPLPYSL
MTLDPCIPGTNIPKKTDAYTSWDSLTDRTYTGRHLPPDPEFNKDGNLPEIKDLKVLFQKR
DGKTIYSPKSTLLFPYWVQWFTDSFLRIDQQNRFKNTSNHQIDMCNVYGLTRKQTNLIRA
FKDGKFKTQKLKRHDGVEEEYPLFYYADPENSIIDPQFEGLHAPLNDEKRQPPEKKAKLF
AMGVERANVQIGYVMLNTLCIREHNRICDILSKNYPEWDDERLFQTARNILMVIVLNIIM
EEYIFHITPYKFKFFADPEAFAKESWYRENWMALEFSLVYRWHSALPEKFIYDGKETPMY
DSLWNNQMLIDKGLGALMEETCSQPGTRIGLFNTPDFPISGTPYTFIDATELASIKLGRQ
AQLASYNDYREMCGFPRVTDFNQITGDEYAQQKLKELYGHVDKIEFFVGLYAEDVRENSA
IPPLVARLIGIDAFSQALTNPLLSPKIFNKDTFSPVGWEIIQNTKTVSDLVNRNVPPSDR
KYKVSFNL

BLAST