GenomeNet

>mic:Mic7113_3623 K11987 prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1] | (GenBank) heme peroxidase family protein (A)
MARDTSRDGLSNKALVYALSNFKPLWNLVQSYEPLKRKINKFFLNSIIYKIPTRPLPYSL
MTLDPCIPGTNIPKKTDAYTSWDSLTDRTYTGRHLPPDPEFNKDGNLPEIKDLKVLFQKR
DGKTIYSPKSTLLFPYWVQWFTDSFLRIDQQNRFKNTSNHQIDMCNVYGLTRKQTNLIRA
FKDGKFKTQKLKRHDGVEEEYPLFYYADPENSIIDPQFEGLHAPLNDEKRQPPEKKAKLF
AMGVERANVQIGYVMLNTLCIREHNRICDILSKNYPEWDDERLFQTARNILMVIVLNIIM
EEYIFHITPYKFKFFADPEAFAKESWYRENWMALEFSLVYRWHSALPEKFIYDGKETPMY
DSLWNNQMLIDKGLGALMEETCSQPGTRIGLFNTPDFPISGTPYTFIDATELASIKLGRQ
AQLASYNDYREMCGFPRVTDFNQITGDEYAQQKLKELYGHVDKIEFFVGLYAEDVRENSA
IPPLVARLIGIDAFSQALTNPLLSPKIFNKDTFSPVGWEIIQNTKTVSDLVNRNVPPSDR
KYKVSFNL

BLAST