GenomeNet

>mid:MIP_00683 DNA ligase-like protein (A)
MAAAEEIDVDGVAVRLTNPDKVYFPKLGSKGTKRHLVEYYRAVAGGPMLDTLRDRPSHLQ
RFPDGIDGEEIYQKRIPQHHPDYVETCQVTFPSGRTADALKVTHPAAIVWAAQMGTITLH
PWQVRCPDTDHPDELRIDLDPQPGVAFEQARTVAVDVLRPLLDELGLVGYPKTSGGRGIH
VFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTAWWKEERGERIFVDFNQNARDRTMA
SAYSVRRTPIATVSMPLTWDELAGAEPDDYTMATVPELVARREDPWAAMDDVAQSIASLL
EMAEADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDRRNGKK

BLAST