GenomeNet

>mid:MIP_05606 glycosyl transferase, group 1 family protein; K16150 glycogen(starch) synthase [EC:2.4.1.11] (A)
MDHEVKILMVSWEYPPVVVGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDPRSHPSSDQ
ISEGVRVIAAAQDPHEFTFGTDMMAWTLAMGHSMVRAGLSLKKPGSSHAWRPDVVHAHDW
LVAHPAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSG
SMADEITELFGPGLAEITVICNGIETARWPFAARRPRTGPAELLYLGRLEYEKGVHDVIA
ALPRVRRTHPGTTLTIAGEGTQQGWLIEQARKHRVFKAIRFVGHLEHAELLAVLHRADAA
VLPSHYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGRTGVSCPPRDVTRLAAAIRTVL
DDPRAAQQRARAARERLTSDFDWHTVADKTAQVYLSAKRGERQPQARLPIVEHALPDR

BLAST