GenomeNet

>mil:ML5_0459 DNA polymerase ligd, polymerase domain-containing protein; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MPSERLKVEVEGRPLELSNLDKVLFPKAGFTKGEVIDYYTRIAPVLLPHLSDRALTRIRF
PNGVDGGSFFEKNAPAATPGWVRTENLPAPGSTKGRETIDYVVCDELPTLVWLANLAALE
LHTPQWKIGAHPDMMVVDLDPGAPAALKQCCRVALLMRDRLASDGISSFPKTSGKKGMQL
CCPIAGTQDADFVSDYAKRIAQELEQAHPKLVVSKMAKNLRPGKIFIDWSQNNAAKTTVA
PYSLRAQSVPSVSTPLTWDEVEAGAAGKRPSTRPYTAGEVLKRVEKQGDLLAPLLDGGPE
LP

BLAST