GenomeNet

>mil:ML5_1895 DNA polymerase ligd, polymerase domain-containing protein (A)
MAGKGAVEEIEVAGHAVRLSSPDRVIFPQRGFTKADVFRYYLAVGDGIMRALRDRPTTLQ
RFPDGIEGEMFFQKRVPQRGVPPWVSTARIAFPSGRPADELCPADLAHVAWAAQMGTVVF
HPWPVRAADTDRPDELRVDLDPQPGTDFADAVTAAAELRGLLDELGVPGWPKTSGGRGVH
VYLRIQPRWTFVEVRRATIALARELERRRPELVTTAWWKEERGERVFVDFNQMARDRTIA
CAYSLRANARATVSTPVDWDELPEVDPDDFHLGTVPARFAERGDPHVGIDDAPWDITPLL
EWAERDAADGLGDMPYPPEYPKMPGEPKRVQPSKDRDRPRP

BLAST