GenomeNet

>mil:ML5_3107 alpha amylase catalytic subunit; K05343 maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1] (A)
MGDRWYQEAVVYCLDVDTYADSDGDGVGDFQGLIGRLDYLARLGVTCLWLNPIHPSPNED
DGYDATDFYNVDPRLGTLGDFAELLHQASNRGIRVIIDLVVNHTSDQHPWFQSARSSPDS
PYRDWYVWADHEPDDRHQGMVFPGEQHETWTYDRTAKAWYYHRFYKFQPDLNIENPKVRA
EIKKITSFWLQLGVSGFRMDAVPFIIERTEPGNPNSPKDFDFLTDLRQHVQWRRGDAVLL
AEANVEPDELPVYFGDGSGSGNRIHMLFDFMLNGRLMLALAREDPEVIIEALRDTPKLPT
GGQWATFLRNHDEIDLSRLTADQRNDVLAKFGPDENMQLYGRGIRRRLAPMLGNDRRHME
LAYSLQFSLRGTPVLRYGEEIGMGENLSLDGRDAIRTPMQWSYADNAGFSTAEPEKLVRP
VIDKGEYGYQKVNVTAQRKDPRSLLGWFERMIRTLREAPETGSGSTTHIDVPMPPGVLAH
RADGRTGTMVFLHNLGTEDVEVDLSTLAPEADLPIDVLSDRNYEDVGKLDRLKLGGYGYR
WIRLCRGHER

BLAST