GenomeNet

>mil:ML5_3231 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (GenBank) Dihydrolipoyllysine-residue acetyltransferase (A)
MSVQQFRLPDVGEGLTEAEIVTWRVAPGDPVGLNDVIVDIETAKAVVELPSPYAGVVDRL
LAGEGQTVEVGAPIIAIRTGDDADAPDAAPAAAPPPADEPAVERTAVLVGYGVSAQARTR
RLRRATPSVRPAEPARPAHTSRPPVLTKPPLRKLAKDLGVELADVRGSGPDGRITRQDLL
DHTTGPAPVADHRRDERLPVRGVRKATAAAMVASAFTAPHVTEFLTVDMTGTVEFVDRLK
QDPAFQGVKVSPLLVASLAVLDAVRRYPDVNTRWDEENQEIVRFADVNLGIAAATPRGLL
VPNVKAAQNLPVRDLAVALNELASTAREGRTRPADLSGGTITITNIGVFGVDAGTPILNP
GEAAILCLGALRRMPWVVDEQVVPRWTAQLSLSFDHRLVDGELGSRVLAHVGRFLEDPLW
GLALR

BLAST