GenomeNet

>mil:ML5_4942 DNA primase small subunit (A)
MTVATTAAQEIQVGERLVRVSSPDKPYFPERGLTKLDVISYFLSVGDGILRALRDRPTML
ERWPRGVFEGAKVATRQTNKGDAFYQKRLPAGAPDWVRTAHITFPSGRTADEVAPSELAV
VIWAANLGTLRFHPWPVSKDDVEHPDQLRIDLDPMPGVGFAQVVPVAHEVRAYLTELGLE
GFPKTTGGRGIHVYVSIEPRWSFGECRRAVLALGREMQRRLPDLVTTTWWRDQRDRPVFV
DYNQMARDHTMTSAYSIRPTPAALVSAPLEWSELDDARPEDFDVLSMPERFAELGDPHAG
LDGRRYSLEALLERADAEGLESPPER

BLAST