GenomeNet

>min:Minf_1263 rbcS; Ribulose bisphosphate carboxylase small subunit; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MRITQGTFSYLPDLTDEEIAAQVQYIIDQGWSIMIEYTDNPHPRHTYWDMWGLPLFDIKD
PAAVMQELNECRKAYPNHYIRISGYNRQQGYQTTMISFICNRPKEEPGFELVRTEWADRQ
QKYQLKPYAIDKPKGQRYKS

BLAST