GenomeNet

>min:Minf_1263 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) rbcS; Ribulose bisphosphate carboxylase small subunit (A)
MRITQGTFSYLPDLTDEEIAAQVQYIIDQGWSIMIEYTDNPHPRHTYWDMWGLPLFDIKD
PAAVMQELNECRKAYPNHYIRISGYNRQQGYQTTMISFICNRPKEEPGFELVRTEWADRQ
QKYQLKPYAIDKPKGQRYKS

BLAST