GenomeNet

>mir:OCQ_03210 hypothetical protein (A)
MAAAEEVDVDGVAVRLTNPDKVYFPKLGSRGTKRHLVEYYRAVAGGPMLDTLRDRPSHLQ
RFPDGIDGEEIYQKRIPQHHPDYLETCQVTFPSGRTADALKVTHPAAIVWAAQMGTITLH
PWQVRCPDTDHPDELRIDLDPQPGVAFEQARTVAVDVLRPLLDELGLVGYPKTSGGRGIH
VFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTAWWKEERGERIFVDFNQNARDRTMA
SAYSVRRTPIATVSMPLTWDELAGAEPDDYTMATVPELVARREDPWAAMDDVAQSIASLL
EMAEADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDRRNGKK

BLAST