GenomeNet

>mir:OCQ_03210 no KO assigned | (GenBank) hypothetical protein (A)
MAAAEEVDVDGVAVRLTNPDKVYFPKLGSRGTKRHLVEYYRAVAGGPMLDTLRDRPSHLQ
RFPDGIDGEEIYQKRIPQHHPDYLETCQVTFPSGRTADALKVTHPAAIVWAAQMGTITLH
PWQVRCPDTDHPDELRIDLDPQPGVAFEQARTVAVDVLRPLLDELGLVGYPKTSGGRGIH
VFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTAWWKEERGERIFVDFNQNARDRTMA
SAYSVRRTPIATVSMPLTWDELAGAEPDDYTMATVPELVARREDPWAAMDDVAQSIASLL
EMAEADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDRRNGKK

BLAST