GenomeNet

>mir:OCQ_30550 DNA polymerase LigD ligase subunit (EC:6.5.1.1); K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MTDFASLPGAVREALYDEPVPDWRSPTLATLTDDRFSDPGWIFERKFDGMRCLAFRDGDR
VRLLSRNRQPLNGTYPELVDALAAQPVTRFVVDGEVVAFDGRRTSFARLQGRLGLTDPDV
ARASPVRVFYYVFDLLHLDGMSTVEVPLLWRKRLLRKAIDFADPLRCAPHRVGDGIAAYR
RACERGDEGVIAKRADSTYQGGRSKNWLKFKCVRDQEFVVGGYTSPKGSRVELGALMLGY
YDGGDLVYAGKVGTGFDDATLRRLHARLSPITRDRPPFARGLVREAGANWVSPEMVVQIG
FSEWTRDGKLRHPRYLGMRTDKEPGEVVRETH

BLAST