GenomeNet

>mir:OCQ_30550 no KO assigned | (GenBank) DNA polymerase LigD ligase subunit (A)
MTDFASLPGAVREALYDEPVPDWRSPTLATLTDDRFSDPGWIFERKFDGMRCLAFRDGDR
VRLLSRNRQPLNGTYPELVDALAAQPVTRFVVDGEVVAFDGRRTSFARLQGRLGLTDPDV
ARASPVRVFYYVFDLLHLDGMSTVEVPLLWRKRLLRKAIDFADPLRCAPHRVGDGIAAYR
RACERGDEGVIAKRADSTYQGGRSKNWLKFKCVRDQEFVVGGYTSPKGSRVELGALMLGY
YDGGDLVYAGKVGTGFDDATLRRLHARLSPITRDRPPFARGLVREAGANWVSPEMVVQIG
FSEWTRDGKLRHPRYLGMRTDKEPGEVVRETH

BLAST