GenomeNet

>mir:OCQ_46970 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) superoxide dismutase, Fe-Zn 1 family protein (A)
MPHYVLPDLTYDYGALEPAISGEIMQLHHDAHHAAYVKGANSTVDQLAEARAERNLAHLP
GLERTLAFHLAGHALHSIFWTNLSPEAAERPEGELAAAIDEFFGGFEAFRAEMTGATSSV
QGSGWGALAWDPIGRRLVVHQIHDHHVSVAITSTPLLVFDAWEHAFYLQYRNVKADYVDR
LWSIVNWADVAVRFEAARRGDLSGLHSSDEIGGAR

BLAST