GenomeNet

>mis:MICPUN_103896 no KO assigned | (RefSeq) hypothetical protein (A)
MAAAASRIELALCFEDVAKNIFGNADGTMTRAQLAAILAADTGLGLQQWELKMFLAEFDL
TDNRVTADKFCSIYSYLASRPPTPAAKDAPAVVAAVAAAPAPGPDPAASAAPADPAAAPA
AAAAPVAVDPALAKRASEKLSGPAAAAVTSMGAAFPPDFLLDPAGAIPAEKLLANLPGDV
YADPDAKFRPFDGVGQYAKMPILGGCGAPYSVCVKSSREYLRDLPPARDVVRLLHLRPDD
DAFVPHPNGISVVLLAFAKLVSADLGLGGDSLAANNPMSSYLDLQVLYGTNAGECDDVRG
GTARGKILPDAAAGRGHVGGAAMEALLTVFSRNHNHLAEAIAAECGDADDESVFQMARHA
NIGAYRSVFLKDFLPYLAAGQHTPDVAPIGDAARGTVRGVNGCVEMDLLMRTFNAMEPPG
GMGGTGTGDGTGDACAAALAEASNVRCGLVARCNLPGRLHAEEVAAVKRARASGVCTLNE
FRAQLGLAAWESFEEMTGGETSLCEKLTAVYGDVDNCELYTGLLCEYNVGNVGAMMPATS
HACSLLLNVVAADKWFQEDALRDESVMGGAVGVRLAEQANLEDLLSQHARVAPPEGGYGV
FEIGGYQVLP

BLAST