GenomeNet

>mis:MICPUN_59858 hypothetical protein; K01113 alkaline phosphatase D [EC:3.1.3.1] (A)
MGVIRLLALAAFVAYSRGDLWDVTGHDSARETAADEHYRGDLRIAFGSCNRHDRAQDLWP
AVRSLSADAWVWLGDAIYADGKVDNVRRYGGRAFHRDAYATQNEHPEYAALRAETRILGT
WDDHDYGFNNAGAEWREKEFAQRLFLDFLGEPLGSPRRTRAGVYEAYTFRGLGASQTGSA
RLILLDARFHASAKDGTLLGDEQWEWFERLMLGRRTGAEGAEGGAEGAEDYYDGDDEGRP
SSEPRGGCVVFDGAEMNENTDCDPVDVTIVGSSVQVHAHTQELLAKMGIGMDIESWNDYP
AERRRLFDLVAAANVRTRAVVLSGDVHHSEIGGSPAGCDLPSELVEITSSGMTHGVLEEL
PTKFLRRLARHSTWGMEYLPPWLFPDVGNLRRRRYVGYNFGEVVVDFGVDWDGDAEGGAE
GGVDDDAFDAAVDASPPANRSPASERDFLRDDVSSSSSSSSSSSRVGRAPRAAAREPTVS
LRIRGVDGGVKLSKTVPFSALEGEWAEYGARGASVSRSRAECRGESSLTAAQTWRLPVML
VGVALAGPAGTSLALWWLWREVGRVRRKRKAD

BLAST