GenomeNet

>mis:MICPUN_59858 K01113 alkaline phosphatase D [EC:3.1.3.1] | (RefSeq) hypothetical protein (A)
MGVIRLLALAAFVAYSRGDLWDVTGHDSARETAADEHYRGDLRIAFGSCNRHDRAQDLWP
AVRSLSADAWVWLGDAIYADGKVDNVRRYGGRAFHRDAYATQNEHPEYAALRAETRILGT
WDDHDYGFNNAGAEWREKEFAQRLFLDFLGEPLGSPRRTRAGVYEAYTFRGLGASQTGSA
RLILLDARFHASAKDGTLLGDEQWEWFERLMLGRRTGAEGAEGGAEGAEDYYDGDDEGRP
SSEPRGGCVVFDGAEMNENTDCDPVDVTIVGSSVQVHAHTQELLAKMGIGMDIESWNDYP
AERRRLFDLVAAANVRTRAVVLSGDVHHSEIGGSPAGCDLPSELVEITSSGMTHGVLEEL
PTKFLRRLARHSTWGMEYLPPWLFPDVGNLRRRRYVGYNFGEVVVDFGVDWDGDAEGGAE
GGVDDDAFDAAVDASPPANRSPASERDFLRDDVSSSSSSSSSSSRVGRAPRAAAREPTVS
LRIRGVDGGVKLSKTVPFSALEGEWAEYGARGASVSRSRAECRGESSLTAAQTWRLPVML
VGVALAGPAGTSLALWWLWREVGRVRRKRKAD

BLAST