GenomeNet

>mis:MICPUN_96728 AMY1; glycoside hydrolase family 13 protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MVPDIAATGVTHLWLPPPSHSVSPEGYLPRHLWNLDSSEYGDQNELVALNASLREAGIMP
VCDVVINHRTADEIGPEGVYNVYSDEVDHTGTAVHWGRHMITCNDPAFHGSGHEDSGDNY
DAAPDLDHANDELRATLKRWLRWLRWDVGFGGFRFDFVRGYAPEYTEEYVKETTSRGDFC
VGENWVDLAWEGSHLNYNQDGPRGKLVEWLAATHGTCALFDFPTKGILQRAVTHVEFYRL
RDPASRPPGLSGWIPSRAVTFVDNHDTGAPQNHWPFPPDRIALGYAYVLTHPGIPCVFGP
HLWGDDPVLSGVIRLLIDLRKRCCVCADAPVKIQMAENDIYVAKVGHRLTVKLGPRYEMP
VELIPKEPEWSLAVAGEDYAVWERVQYDTDADAKVVAMEREMMDVGDDGEYYPLERVPVD
NSRQSIGSWIEPPPGIVEPSDGEADPR

BLAST