GenomeNet

>mit:OCO_03170 no KO assigned | (GenBank) hypothetical protein (A)
MAAAEEIDVDGVAVRLTNPDKVYFPKLGSKGTKRHLVEYYRAVAGGPMLDTLRDRPSHLQ
RFPDGIDGEEIYQKRIPQHHPDYLEACQVTFPSGRTADALKVTHPAAIVWAAQMGTITLH
PWQVRCPDTDHPDELRIDLDPQPGVAFEQARTVAVDVLRPLLDELGLVGYPKTSGGRGIH
VFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTAWWKEERGERIFVDFNQNARDRTMA
SAYSVRRTPIATVSMPLTWDELAGAEPDDYTMATVPELVARREDPWAAMDDVAQSIASLL
EMAEADEECGLGDMPYPPNYPKMPGEPKRVQPSRDTDRRNGKK

BLAST