GenomeNet

>mja:MJ_0414 K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] | (GenBank) conserved hypothetical protein (A)
MRLIMMKVSAYDLNKIAEKLNLSIKDLNKAFSRKILREDEYKEIKTLLFKKEFKGIEKGT
VIFLNDNLDVVRGYPKTYRAITLYPTIKKHFIDKVVIEEKLNGYNIRIVKIDGEVYALTR
SGYICPFTTKKVKKFLNLEILDDYSEYMLCGEMIGINNPYTPYYYKEVDRGFENLGFYIF
DIKERETNKSLPIKERINLCEKYNLPYVKPLAVVDKDEAHIHVREIIEKLNKEGREGVVL
KDPDMAVSPIKYTTHYTQCEDLKSAFTFFFDLGMDFLFSRVVREGFMSYEFKETLEERKN
RAKDLGEAILLPMVETINKVASGERVSEDFELIFDSEEDFDEFLDFMRKMKMVITIKNIE
KIDTEEGVKIKAVIGKIYNKTNDKIISYLNGTLWE

BLAST