GenomeNet

>mja:MJ_0600 restriction enzyme, type II R/M system 2; K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MNFEYIINSLLETIKTYNFFVDWEKIENNIKKIEKRLHILNYLIGKENFKEEFFELLKEY
PEVITVFPILIAVRDNKITILNENMELETLEFKEKKYLTDEEIERYYKFFKETGLEDLLK
NRKIKNLVDYVFGVEVGMDTNARKNRIGDLMENIVKKYIENLCKQNKNLDYIFQATKDKI
KQKWGINLTLDKTNRKFDFAVFNKNTKKLYLIEVNFYSGGGSKLKATAGEYRSLNEFIKN
NNNNVQFIWITDGKGWNTAKNPLKESFNSGVVILNLKMVKEGLLKEILTQ

BLAST