GenomeNet

>mja:MJ_1235 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) ribulose bisphosphate carboxylase, large subunit (rbcL) (A)
MDYINLNYRPNEGDLLSCMVIKGENLEKLANEIAGESSIGTWTKVQTMKSDIYEKLRPKV
YEIKEIGEENGYKVGLIKIAYPLYDFEINNMPGVLAGIAGNIFGMKIAKGLRILDFRFPA
EFVKAYKGPRFGIEGVRETLKIKERPLLGTIVKPKVGLKTEEHAKVAYEAWVGGVDLVKD
DENLTSQEFNKFEDRIYKTLEMRDKAEEETGERKAYMPNITAPYREMIRRAEIAEDAGSE
YVMIDVVVCGFSAVQSFREEDFKFIIHAHRAMHAAMTRSRDFGISMLALAKIYRLLGVDQ
LHIGTVVGKMEGGEKEVKAIRDEIVYDKVEADNENKFFNQDWFDIKPVFPVSSGGVHPRL
VPKIVEILGRDLIIQAGGGVHGHPDGTRAGAKAMRAAIEAIIEGKSLEEKAEEVAELKKA
LEYWK

BLAST