GenomeNet

>mja:MJ_1235 ribulose bisphosphate carboxylase, large subunit (rbcL); K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MDYINLNYRPNEGDLLSCMVIKGENLEKLANEIAGESSIGTWTKVQTMKSDIYEKLRPKV
YEIKEIGEENGYKVGLIKIAYPLYDFEINNMPGVLAGIAGNIFGMKIAKGLRILDFRFPA
EFVKAYKGPRFGIEGVRETLKIKERPLLGTIVKPKVGLKTEEHAKVAYEAWVGGVDLVKD
DENLTSQEFNKFEDRIYKTLEMRDKAEEETGERKAYMPNITAPYREMIRRAEIAEDAGSE
YVMIDVVVCGFSAVQSFREEDFKFIIHAHRAMHAAMTRSRDFGISMLALAKIYRLLGVDQ
LHIGTVVGKMEGGEKEVKAIRDEIVYDKVEADNENKFFNQDWFDIKPVFPVSSGGVHPRL
VPKIVEILGRDLIIQAGGGVHGHPDGTRAGAKAMRAAIEAIIEGKSLEEKAEEVAELKKA
LEYWK

BLAST